Skip to main content

Table 1 SLA-2*HB01-AS64-sβ2m complex information

From: Expression, purification, crystallization and preliminary X-ray diffraction analysis of swine leukocyte antigen 2 complexed with a CTL epitope AS64 derived from Asia1 serotype of foot-and-mouth disease virus

Source organism Sus scrofa
DNA source Plasmid DNA
Upper primer GGAATTCCATATGGGCCCGCATTCCCTGAGCTATTCTTAC
Lower primer AGTCTCGAGTTAGTCCCATCTCAGGGTGAGGGGCTCCTGC
Cloning vector pMD®19-T simple
Expression vector pET21a (+)
Expression host E. coli (Rosetta)
Complete amino-acid sequence of the construct produced GPHSLSYSYTAVSRPDRGDSRFFIVGYVDDTQFVRFDSDAPNAKMEPRAQWIQQEGQEYWDRETQISKETAQNYRVDLNTLRGYYNQSEAGSRTIQRVYGCYLGPDGLLLRGYRQDAYDGADYIALNEDLRSWTAADMAAQITKRKWEVVNEAEGERSYLQGRCVEWLQKYLVMGKDTLQRAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLSWQREGQDQSQDMELVETRPSGDGTFQKWAALVVPPGEEQSYTCHVQHEGLQEPLTL
RWALLRSATYYVARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH
  1. The restriction-enzyme cleavage sites are underlined in the upper and lower primers. The normal font, bold and italics of residues expressed by the vector are from the heavy chain of SLA-2*HB01, AS64 and the light chain of sβ2m in the amino-acid sequences, respectively