Skip to main content

Table 1 Sequences and properties of peptides used in this study

From: Tissue expression and antibacterial activity of host defense peptides in chicken

Name Length (aa) Composition Mw (g/mol) Net charge Hydrophobic ratio
AvBD1 40 GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIWG 4567.55 7.7 32
AvBD2 39 RDMLFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA 4324.14 3.9 36
AvBD3 36 TATQCRIRGGFCRVGSCRFPHIAIGKCATFISCCGR 3877.62 5.8 33
AvBD4 37 RYHMQCGYRGTFCTPGKCPYGNAYLGLCRPKYSCCRW 4341.08 5.8 24
AvBD5 37 GLPQDCERRGGFCSHKSCPPGIGRIGLCSKEDFCCRS 4000.59 1.8 24
AvBD6 38 SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVR 4216.96 5.8 32
AvBD7 37 RPIDTCRLRNGLCFPGICRRPYYWIGTCNNGIGSCCAR 4307.05 4.7 32
AvBD8 41 NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCCRTVYD 4593.16 0.1 24
AvBD9 42 ADTLACRQSMGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS 4353.13 3.7 36
AvBD10 42 PDTVACRTQGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ 4309.01 1.8 38
AvBD11 39 RDTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCVD 4431.14 4.8 28
AvBD12 44 PDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILLCCKPLSPTPTKT 4841.64 0.8 36
AvBD13 37 SDSQLCRNNHGHCRRLCFHMESWAGSCMNGRLRCCRF 4373.03 4 24
AvBD14 37 DTVTCRKMKGKCSFLLCPFFKRSSGTCYNGLAKCCRP 4151 6.7 30
CATH1 28 PVRVKRVWPLVIRTVIAGYNLYRAIKKK 3338.14 8 53
CATB1 40 PIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQP 5028.86 7.1 45
CATH2 34 PVLVQRGRFGRFLRKIRRFRPKVTITIQGSARFG 4014.84 10 44
CATH3 31 PVRVKRFWPLVPVAINTVAAGINLYKAIRRK 3547.35 7 61
cNK3 30 PDEDAINNALNKVCSTGRRQRSICKQLLKK 3399.95 3.9 30
  1. Molecular weight, net charge at pH7 and hydrophobic ratio were calculated using Peptide property calculator (http://www.innovagen.proteomics-tools)